PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G208100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 268aa    MW: 29197 Da    PI: 5.1715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G208100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.1e-151461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv      G  +W ++++  g+ R++k+c++rw +yl
  Sevir.2G208100.1.p 14 KGPWTAEEDQKLVSFLVNNGQCCWGAVPKLAGLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding54.62.5e-1770111447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++eE+e  ++++++lG++ W++Ia+ ++ gRt++++k++w+++
  Sevir.2G208100.1.p  70 LSPEEEETVINLHAELGNR-WSKIASQLP-GRTDNDIKNHWNTH 111
                         69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-19562IPR009057Homeodomain-like
PROSITE profilePS5129412.765961IPR017930Myb domain
SuperFamilySSF466898.99E-2711108IPR009057Homeodomain-like
SMARTSM007172.9E-111363IPR001005SANT/Myb domain
PfamPF002491.7E-131461IPR001005SANT/Myb domain
CDDcd001673.36E-81661No hitNo description
PROSITE profilePS5129428.03562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2663116IPR009057Homeodomain-like
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002491.4E-1570111IPR001005SANT/Myb domain
CDDcd001672.12E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLV NNGQCCWGAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SPEEEETVIN LHAELGNRWS KIASQLPGRT DNDIKNHWNT HIKKKLRKMG  120
IDPATHKPLQ PAPPQPNEEE KAAAASAIVS GVELGNEAFS ISEVPMVHLL DDVVLPYDLV  180
AGAPPASNSG IDTAYSPEPS SSSSSCSGSA TASSCASSVV DGECRNWLEW AESMLLDDVV  240
TGPAPWTFED PFVTYQRIAL FDHQETW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0837351e-134BT083735.2 Zea mays full-length cDNA clone ZM_BFb0033K01 mRNA, complete cds.
GenBankBT0855211e-134BT085521.2 Zea mays full-length cDNA clone ZM_BFc0028P12 mRNA, complete cds.
GenBankBT0856251e-134BT085625.2 Zea mays full-length cDNA clone ZM_BFc0040A03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956764.10.0PREDICTED: myb-related protein 315-like
TrEMBLK4A0V70.0K4A0V7_SETIT; Uncharacterized protein
STRINGSi032498m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-83myb domain protein 20